SLC1A1 antibody (70R-6796)

Rabbit polyclonal SLC1A1 antibody

Synonyms Polyclonal SLC1A1 antibody, Anti-SLC1A1 antibody, Neuronal High Affinity Glutamate Transporter 1 antibody, SLCA 1 antibody, EAAT3 antibody, SLC1A1, SLCA-1 antibody, EAAC1 antibody, SLCA 1, SLCA-1, Solute Carrier Family 1 Neuronal high affinity Glutamate Transporter Member 1 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC1A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAI
Assay Information SLC1A1 Blocking Peptide, catalog no. 33R-4852, is also available for use as a blocking control in assays to test for specificity of this SLC1A1 antibody


Western Blot analysis using SLC1A1 antibody (70R-6796)

SLC1A1 antibody (70R-6796) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC1A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC1A1 transports L-glutamate and also L- and D-aspartate. It is essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. SLC1A1 acts as a symport by cotransporting sodium.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC1A1 antibody (70R-6796) | SLC1A1 antibody (70R-6796) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors