SLC1A2 antibody (70R-6543)

Rabbit polyclonal SLC1A2 antibody

Synonyms Polyclonal SLC1A2 antibody, Anti-SLC1A2 antibody, SLCA2-1 antibody, SLCA2-1, Glial High Affinity Glutamate Transporter 2 antibody, Solute Carrier Family 1 Glial high affinity Glutamate Transporter Member 2 antibody, SLC1A2, EAAT2 antibody, GLT-1 antibody, SLCA2 1, SLCA2 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC1A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM
Assay Information SLC1A2 Blocking Peptide, catalog no. 33R-5500, is also available for use as a blocking control in assays to test for specificity of this SLC1A2 antibody

Images

Western blot analysis using SLC1A2 antibody (70R-6543)

Recommended SLC1A2 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC1A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SLC1A2 antibody (70R-6543) | Recommended SLC1A2 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using SLC1A2 antibody (70R-6543) | Brain, cortex

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors