SLC20A1 antibody (70R-5989)

Rabbit polyclonal SLC20A1 antibody

Synonyms Polyclonal SLC20A1 antibody, Anti-SLC20A1 antibody, SLCA1 20, SLCA1-20 antibody, DKFZp686J2397 antibody, FLJ41426 antibody, PiT-1 antibody, Phosphate Transporter 1 antibody, SLC20A1, SLCA1-20, GLVR1 antibody, PIT1 antibody, SLCA1 20 antibody, Glvr-1 antibody, Solute Carrier Family 20 Member 1 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC20A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL
Assay Information SLC20A1 Blocking Peptide, catalog no. 33R-5497, is also available for use as a blocking control in assays to test for specificity of this SLC20A1 antibody

Images

Western Blot analysis using SLC20A1 antibody (70R-5989)

SLC20A1 antibody (70R-5989) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC20A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 for gibbon ape leukemia virus. These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC20A1 antibody (70R-5989) | SLC20A1 antibody (70R-5989) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors