SLC20A2 antibody (70R-7534)

Rabbit polyclonal SLC20A2 antibody

Synonyms Polyclonal SLC20A2 antibody, Anti-SLC20A2 antibody, PIT-2 antibody, SLCA2 20, SLCA2-20, MLVAR antibody, SLCA2 20 antibody, Phosphate Transporter 2 antibody, GLVR2 antibody, SLC20A2, Solute Carrier Family 20 Member 2 antibody, Glvr-2 antibody, SLCA2-20 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen SLC20A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF
Assay Information SLC20A2 Blocking Peptide, catalog no. 33R-2221, is also available for use as a blocking control in assays to test for specificity of this SLC20A2 antibody

Images

Western Blot analysis using SLC20A2 antibody (70R-7534)

SLC20A2 antibody (70R-7534) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC20A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC20A2 is a sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. It may play a role in extracellular matrix, cartilage and vascular calcification.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC20A2 antibody (70R-7534) | SLC20A2 antibody (70R-7534) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors