SLC22A1 antibody (70R-1728)

Rabbit polyclonal SLC22A1 antibody

Synonyms Polyclonal SLC22A1 antibody, Anti-SLC22A1 antibody, SLC22A1, Organic Cation Transporter 1 antibody, Solute Carrier Family 22 Member 1 antibody, oct1_cds antibody, SLCA1-22, HOCT1 antibody, SLCA1 22, OCT1 antibody, SLCA1 22 antibody, SLCA1-22 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC22A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAIQMICLVNAELYPTFVSGVGPACRGSDATSSRDQGGRFARDHEGRREP
Assay Information SLC22A1 Blocking Peptide, catalog no. 33R-3892, is also available for use as a blocking control in assays to test for specificity of this SLC22A1 antibody


Immunohistochemical staining using SLC22A1 antibody (70R-1728)

SLC22A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC22A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC22A1 antibody (70R-1728) | SLC22A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using SLC22A1 antibody (70R-1728) | SLC22A1 antibody (70R-1728) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors