SLC22A11 antibody (70R-1885)

Rabbit polyclonal SLC22A11 antibody

Synonyms Polyclonal SLC22A11 antibody, Anti-SLC22A11 antibody, OAT4 antibody, SLCA11-22 antibody, MGC34282 antibody, SLCA11 22, Solute Carrier Family 22 Member 11 antibody, hOAT4 antibody, Organic Anion/Urate Transporter 11 antibody, SLC22A11, SLCA11-22, SLCA11 22 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC22A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW
Assay Information SLC22A11 Blocking Peptide, catalog no. 33R-5653, is also available for use as a blocking control in assays to test for specificity of this SLC22A11 antibody

Images

Western Blot analysis using SLC22A11 antibody (70R-1885)

SLC22A11 antibody (70R-1885) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC22A11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A11 is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC22A11 antibody (70R-1885) | SLC22A11 antibody (70R-1885) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors