SLC22A12 antibody (70R-7371)

Rabbit polyclonal SLC22A12 antibody

Synonyms Polyclonal SLC22A12 antibody, Anti-SLC22A12 antibody, SLCA12-22, SLCA12 22, URAT1 antibody, OAT4L antibody, RST antibody, SLC22A12, SLCA12 22 antibody, Organic Anion/Urate Transporter 12 antibody, Solute Carrier Family 22 Member 12 antibody, SLCA12-22 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC22A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR
Assay Information SLC22A12 Blocking Peptide, catalog no. 33R-8641, is also available for use as a blocking control in assays to test for specificity of this SLC22A12 antibody

Images

Western Blot analysis using SLC22A12 antibody (70R-7371)

SLC22A12 antibody (70R-7371) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC22A12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC22A12 is required for efficient urate re-absorption in the kidney. SLC22A12 regulates blood urate levels. SLC22A12 mediates saturable urate uptake by facilitating the exchange of urate against organic anions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC22A12 antibody (70R-7371) | SLC22A12 antibody (70R-7371) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors