SLC22A14 antibody (70R-6292)

Rabbit polyclonal SLC22A14 antibody raised against the N terminal of SLC22A14

Synonyms Polyclonal SLC22A14 antibody, Anti-SLC22A14 antibody, ORCTL4 antibody, SLCA14 22 antibody, OCTL4 antibody, SLCA14-22, SLCA14 22, MGC163415 antibody, SLC22A14, Solute Carrier Family 22 Member 14 antibody, OCTL2 antibody, SLCA14-22 antibody
Specificity SLC22A14 antibody was raised against the N terminal of SLC22A14
Cross Reactivity Human
Applications WB
Immunogen SLC22A14 antibody was raised using the N terminal of SLC22A14 corresponding to a region with amino acids IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG
Assay Information SLC22A14 Blocking Peptide, catalog no. 33R-4005, is also available for use as a blocking control in assays to test for specificity of this SLC22A14 antibody

Images

Western Blot analysis using SLC22A14 antibody (70R-6292)

SLC22A14 antibody (70R-6292) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC22A14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC22A14 antibody (70R-6292) | SLC22A14 antibody (70R-6292) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors