SLC22A15 antibody (70R-7280)

Rabbit polyclonal SLC22A15 antibody raised against the middle region of SLC22A15

Synonyms Polyclonal SLC22A15 antibody, Anti-SLC22A15 antibody, SLC22A15, SLCA15 22, DKFZp761G0313 antibody, FLIPT1 antibody, Solute Carrier Family 22 Member 15 antibody, PRO34686 antibody, SLCA15-22 antibody, SLCA15 22 antibody, SLCA15-22
Specificity SLC22A15 antibody was raised against the middle region of SLC22A15
Cross Reactivity Human
Applications WB
Immunogen SLC22A15 antibody was raised using the middle region of SLC22A15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK
Assay Information SLC22A15 Blocking Peptide, catalog no. 33R-6840, is also available for use as a blocking control in assays to test for specificity of this SLC22A15 antibody

Images

Western Blot analysis using SLC22A15 antibody (70R-7280)

SLC22A15 antibody (70R-7280) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC22A15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC22A15 antibody (70R-7280) | SLC22A15 antibody (70R-7280) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors