SLC22A16 antibody (70R-1824)

Rabbit polyclonal SLC22A16 antibody

Synonyms Polyclonal SLC22A16 antibody, Anti-SLC22A16 antibody, Solute Carrier Family 22 Member 16 antibody, dJ261K5.1 antibody, Organic Cation Transporter 16 antibody, SLC22A16, CT2 antibody, OCT6 antibody, OKB1 antibody, SLCA16 22, SLCA16 22 antibody, SLCA16-22 antibody, SLCA16-22, FLIPT2 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC22A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
Assay Information SLC22A16 Blocking Peptide, catalog no. 33R-1816, is also available for use as a blocking control in assays to test for specificity of this SLC22A16 antibody

Images

Immunohistochemical staining using SLC22A16 antibody (70R-1824)

SLC22A16 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC22A16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC22A16 antibody (70R-1824) | SLC22A16 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLC22A16 antibody (70R-1824) | SLC22A16 antibody (70R-1824) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors