SLC22A17 antibody (70R-6802)

Rabbit polyclonal SLC22A17 antibody raised against the middle region of SLC22A17

Synonyms Polyclonal SLC22A17 antibody, Anti-SLC22A17 antibody, NGALR antibody, SLCA17-22 antibody, BOIT antibody, hBOIT antibody, Solute Carrier Family 22 Member 17 antibody, SLC22A17, BOCT antibody, SLCA17 22, SLCA17-22, SLCA17 22 antibody
Specificity SLC22A17 antibody was raised against the middle region of SLC22A17
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC22A17 antibody was raised using the middle region of SLC22A17 corresponding to a region with amino acids HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM
Assay Information SLC22A17 Blocking Peptide, catalog no. 33R-3704, is also available for use as a blocking control in assays to test for specificity of this SLC22A17 antibody

Images

Western Blot analysis using SLC22A17 antibody (70R-6802)

SLC22A17 antibody (70R-6802) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC22A17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of SLC22A17 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC22A17 antibody (70R-6802) | SLC22A17 antibody (70R-6802) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors