SLC22A18 antibody (70R-6653)

Rabbit polyclonal SLC22A18 antibody raised against the N terminal of SLC22A18

Synonyms Polyclonal SLC22A18 antibody, Anti-SLC22A18 antibody, Solute Carrier Family 22 Member 18 antibody, ORCTL2 antibody, IMPT1 antibody, BWSCR1A antibody, DKFZp667A184 antibody, TSSC5 antibody, SLC22A1L antibody, p45-BWR1A antibody, SLCA18-22 antibody, SLCA18 22 antibody, BWR1A antibody, SLC22A18, HET antibody, SLCA18 22, SLCA18-22, ITM antibody
Specificity SLC22A18 antibody was raised against the N terminal of SLC22A18
Cross Reactivity Human
Applications WB
Immunogen SLC22A18 antibody was raised using the N terminal of SLC22A18 corresponding to a region with amino acids AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG
Assay Information SLC22A18 Blocking Peptide, catalog no. 33R-1050, is also available for use as a blocking control in assays to test for specificity of this SLC22A18 antibody

Images

Western Blot analysis using SLC22A18 antibody (70R-6653)

SLC22A18 antibody (70R-6653) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC22A18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC22A18 antibody (70R-6653) | SLC22A18 antibody (70R-6653) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors