SLC22A18 antibody (70R-6958)

Rabbit polyclonal SLC22A18 antibody raised against the middle region of SLC22A18

Synonyms Polyclonal SLC22A18 antibody, Anti-SLC22A18 antibody, ORCTL2 antibody, SLC22A18, ITM antibody, BWR1A antibody, SLCA18-22, p45-BWR1A antibody, HET antibody, IMPT1 antibody, SLC22A1L antibody, DKFZp667A184 antibody, TSSC5 antibody, SLCA18-22 antibody, SLCA18 22 antibody, Solute Carrier Family 22 Member 18 antibody, BWSCR1A antibody, SLCA18 22
Specificity SLC22A18 antibody was raised against the middle region of SLC22A18
Cross Reactivity Human
Applications WB
Immunogen SLC22A18 antibody was raised using the middle region of SLC22A18 corresponding to a region with amino acids IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK
Assay Information SLC22A18 Blocking Peptide, catalog no. 33R-4110, is also available for use as a blocking control in assays to test for specificity of this SLC22A18 antibody

Images

Western Blot analysis using SLC22A18 antibody (70R-6958)

SLC22A18 antibody (70R-6958) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC22A18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC22A18 antibody (70R-6958) | SLC22A18 antibody (70R-6958) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors