SLC22A18 Blocking Peptide (33R-1050)

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A18 antibody, catalog no. 70R-6653

Synonyms SLC22A18 control peptide, SLC22A18 antibody Blocking Peptide, Anti-SLC22A18 Blocking Peptide, Solute Carrier Family 22 Member 18 Blocking Peptide, BWR1A Blocking Peptide, BWSCR1A Blocking Peptide, DKFZp667A184 Blocking Peptide, HET Blocking Peptide, IMPT1 Blocking Peptide, ITM Blocking Peptide, ORCTL2 Blocking Peptide, SLC22A1L Blocking Peptide, TSSC5 Blocking Peptide, p45-BWR1A Blocking Peptide, SLC22A18, SLCA18-22, SLCA18 22, SLCA18-22 Blocking Peptide, SLCA18 22 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG
Molecular Weight 45 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors