SLC22A6 antibody (70R-7525)

Rabbit polyclonal SLC22A6 antibody

Synonyms Polyclonal SLC22A6 antibody, Anti-SLC22A6 antibody, PAHT antibody, MGC45260 antibody, Solute Carrier Family 22 Member 6 antibody, OAT1 antibody, HOAT1 antibody, SLCA6 22 antibody, ROAT1 antibody, SLCA6-22, SLCA6 22, SLCA6-22 antibody, SLC22A6, Organic Anion Transporter 6 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC22A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQTRQQQEHQKYMVPLQA
Assay Information SLC22A6 Blocking Peptide, catalog no. 33R-2764, is also available for use as a blocking control in assays to test for specificity of this SLC22A6 antibody

Images

Western Blot analysis using SLC22A6 antibody (70R-7525)

SLC22A6 antibody (70R-7525) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC22A6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC22A6 antibody (70R-7525) | SLC22A6 antibody (70R-7525) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors