SLC22A7 antibody (70R-1912)

Rabbit polyclonal SLC22A7 antibody

Synonyms Polyclonal SLC22A7 antibody, Anti-SLC22A7 antibody, NLT antibody, SLC22A7, Organic Anion Transporter 7 antibody, SLCA7 22 antibody, MGC24091 antibody, OAT2 antibody, SLCA7-22, SLCA7-22 antibody, Solute Carrier Family 22 Member 7 antibody, MGC45202 antibody, SLCA7 22
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS
Assay Information SLC22A7 Blocking Peptide, catalog no. 33R-5265, is also available for use as a blocking control in assays to test for specificity of this SLC22A7 antibody

Images

Western Blot analysis using SLC22A7 antibody (70R-1912)

SLC22A7 antibody (70R-1912) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC22A7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC22A7 antibody (70R-1912) | SLC22A7 antibody (70R-1912) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors