SLC24A4 antibody (70R-6806)

Rabbit polyclonal SLC24A4 antibody

Synonyms Polyclonal SLC24A4 antibody, Anti-SLC24A4 antibody, SLCA4-24, SLC24A2 antibody, NCKX4 antibody, SLCA4 24, SLCA4-24 antibody, Sodium/Potassium/Calcium Exchanger 4 antibody, SLC24A4, FLJ38852 antibody, Solute Carrier Family 24 Member 4 antibody, SLCA4 24 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC24A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTI
Assay Information SLC24A4 Blocking Peptide, catalog no. 33R-7357, is also available for use as a blocking control in assays to test for specificity of this SLC24A4 antibody

Images

Western Blot analysis using SLC24A4 antibody (70R-6806)

SLC24A4 antibody (70R-6806) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC24A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Potassium-dependent sodium/calcium exchangers, such as NCKX4, are thought to transport 1 intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC24A4 antibody (70R-6806) | SLC24A4 antibody (70R-6806) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors