SLC25A1 antibody (70R-6508)

Rabbit polyclonal SLC25A1 antibody

Synonyms Polyclonal SLC25A1 antibody, Anti-SLC25A1 antibody, SLCA1-25, Solute Carrier Family 25 Member 1 antibody, Mitochondrial Carrier Citrate Transporter 1 antibody, SLCA1-25 antibody, CTP antibody, SLCA1 25, SLC25A1, SLCA1 25 antibody, SLC20A3 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC25A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGL
Assay Information SLC25A1 Blocking Peptide, catalog no. 33R-6746, is also available for use as a blocking control in assays to test for specificity of this SLC25A1 antibody

Images

Western Blot analysis using SLC25A1 antibody (70R-6508)

SLC25A1 antibody (70R-6508) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The mitochondrial tricarboxylate transporter (also called citrate transport protein, or CTP) is responsible for the movement of citrate across the mitochondrial inner membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A1 antibody (70R-6508) | SLC25A1 antibody (70R-6508) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors