SLC25A11 antibody (70R-6507)

Rabbit polyclonal SLC25A11 antibody

Synonyms Polyclonal SLC25A11 antibody, Anti-SLC25A11 antibody, SLC25A11, SLCA11-25 antibody, SLCA11 25, SLCA11 25 antibody, Mitochondrial Carrier Oxoglutarate Carrier 11 antibody, Solute Carrier Family 25 Member 11 antibody, SLCA11-25, SLC20A4 antibody, OGC antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC25A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM
Assay Information SLC25A11 Blocking Peptide, catalog no. 33R-1955, is also available for use as a blocking control in assays to test for specificity of this SLC25A11 antibody

Images

Western Blot analysis using SLC25A11 antibody (70R-6507)

SLC25A11 antibody (70R-6507) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A11 antibody (70R-6507) | SLC25A11 antibody (70R-6507) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors