SLC25A11 Blocking Peptide (33R-1051)

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A11 antibody, catalog no. 70R-6506

Synonyms SLC25A11 control peptide, SLC25A11 antibody Blocking Peptide, Anti-SLC25A11 Blocking Peptide, Solute Carrier Family 25 Member 11 Blocking Peptide, Mitochondrial Carrier Oxoglutarate Carrier 11 Blocking Peptide, OGC Blocking Peptide, SLC20A4 Blocking Peptide, SLC25A11, SLCA11-25, SLCA11 25, SLCA11-25 Blocking Peptide, SLCA11 25 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQL
Molecular Weight 34 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors