SLC25A14 antibody (70R-1750)

Rabbit polyclonal SLC25A14 antibody

Synonyms Polyclonal SLC25A14 antibody, Anti-SLC25A14 antibody, SLCA14 25 antibody, SLCA14-25, SLCA14 25, Solute Carrier Family 25 Member 14 antibody, SLC25A14, SLCA14-25 antibody, Mitochondrial Carrier Brain 14 antibody
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen SLC25A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV
Assay Information SLC25A14 Blocking Peptide, catalog no. 33R-8540, is also available for use as a blocking control in assays to test for specificity of this SLC25A14 antibody


Western Blot analysis using SLC25A14 antibody (70R-1750)

SLC25A14 antibody (70R-1750) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC25A14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-terminal hydrophobic domain that is not present in other UCPs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC25A14 antibody (70R-1750) | SLC25A14 antibody (70R-1750) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors