SLC25A16 antibody (70R-6499)

Rabbit polyclonal SLC25A16 antibody

Synonyms Polyclonal SLC25A16 antibody, Anti-SLC25A16 antibody, SLCA16 25 antibody, SLC25A16, GDC antibody, GDA antibody, hML7 antibody, SLCA16 25, D10S105E antibody, ML7 antibody, Mitochondrial Carrier Graves Disease Autoantigen 16 antibody, SLCA16-25 antibody, Solute Carrier Family 25 Member 16 antibody, HGT.1 antibody, SLCA16-25, MGC39851 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC25A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRR
Assay Information SLC25A16 Blocking Peptide, catalog no. 33R-5430, is also available for use as a blocking control in assays to test for specificity of this SLC25A16 antibody

Images

Western Blot analysis using SLC25A16 antibody (70R-6499)

SLC25A16 antibody (70R-6499) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A16 is a protein that contains three tandemly repeated mitochondrial carrier protein domains. The protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. SLC25A16 gene has a possible role in Graves' disease.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A16 antibody (70R-6499) | SLC25A16 antibody (70R-6499) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors