SLC25A20 antibody (70R-6485)

Rabbit polyclonal SLC25A20 antibody

Synonyms Polyclonal SLC25A20 antibody, Anti-SLC25A20 antibody, SLCA20-25, SLCA20 25, CAC antibody, Solute Carrier Family 25 Member 20 antibody, SLCA20 25 antibody, SLCA20-25 antibody, CACT antibody, Carnitine/Acylcarnitine Translocase 20 antibody, SLC25A20
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC25A20 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSL
Assay Information SLC25A20 Blocking Peptide, catalog no. 33R-3287, is also available for use as a blocking control in assays to test for specificity of this SLC25A20 antibody

Images

Western Blot analysis using SLC25A20 antibody (70R-6485)

SLC25A20 antibody (70R-6485) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A20 is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space.It mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A20 antibody (70R-6485) | SLC25A20 antibody (70R-6485) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors