SLC25A21 antibody (70R-6493)

Rabbit polyclonal SLC25A21 antibody

Synonyms Polyclonal SLC25A21 antibody, Anti-SLC25A21 antibody, SLCA21 25 antibody, SLC25A21, Mitochondrial Oxodicarboxylate Carrier 21 antibody, SLCA21-25, ODC antibody, MGC126570 antibody, SLCA21-25 antibody, ODC1 antibody, Solute Carrier Family 25 Member 21 antibody, SLCA21 25
Cross Reactivity Human
Applications WB
Immunogen SLC25A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGIL
Assay Information SLC25A21 Blocking Peptide, catalog no. 33R-5192, is also available for use as a blocking control in assays to test for specificity of this SLC25A21 antibody

Images

Western Blot analysis using SLC25A21 antibody (70R-6493)

SLC25A21 antibody (70R-6493) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A21 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A21 antibody (70R-6493) | SLC25A21 antibody (70R-6493) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors