SLC25A22 antibody (70R-6511)

Rabbit polyclonal SLC25A22 antibody

Synonyms Polyclonal SLC25A22 antibody, Anti-SLC25A22 antibody, SLCA22 25 antibody, SLC25A22, Mitochondrial Carrier Glutamate 22 antibody, SLCA22-25, SLCA22 25, Solute Carrier Family 25 Member 22 antibody, GC1 antibody, SLCA22-25 antibody, FLJ13044 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC25A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV
Assay Information SLC25A22 Blocking Peptide, catalog no. 33R-9708, is also available for use as a blocking control in assays to test for specificity of this SLC25A22 antibody


Western Blot analysis using SLC25A22 antibody (70R-6511)

SLC25A22 antibody (70R-6511) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A22 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The SLC25 family is mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane. SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC25A22 antibody (70R-6511) | SLC25A22 antibody (70R-6511) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors