SLC25A24 antibody (70R-6468)

Rabbit polyclonal SLC25A24 antibody

Synonyms Polyclonal SLC25A24 antibody, Anti-SLC25A24 antibody, SLCA24 25 antibody, APC1 antibody, Mitochondrial Carrier Phosphate Carrier 24 antibody, SLCA24-25 antibody, Solute Carrier Family 25 Member 24 antibody, SCAMC-1 antibody, SLC25A24, SLCA24-25, DKFZp586G0123 antibody, SLCA24 25
Cross Reactivity Human
Applications WB
Immunogen SLC25A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDSLYGDLFWYLDYNKDGTLDIFELQEGLEDVGAIQSLEEAKKIFTTGDV
Assay Information SLC25A24 Blocking Peptide, catalog no. 33R-5869, is also available for use as a blocking control in assays to test for specificity of this SLC25A24 antibody

Images

Western Blot analysis using SLC25A24 antibody (70R-6468)

SLC25A24 antibody (70R-6468) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A24 antibody (70R-6468) | SLC25A24 antibody (70R-6468) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors