SLC25A25 antibody (70R-6750)

Rabbit polyclonal SLC25A25 antibody

Synonyms Polyclonal SLC25A25 antibody, Anti-SLC25A25 antibody, MGC119514 antibody, SLCA-25, SLCA-25 antibody, MGC105138 antibody, MGC119516 antibody, Mitochondrial Carrier Phosphate Carrier 25 antibody, SLC25A25, MGC119515 antibody, Solute Carrier Family 25 Member 25 antibody, KIAA1896 antibody, PCSCL antibody, MCSC antibody, SLCA 25, SCAMC-2 antibody, RP11-395P17.4 antibody, SLCA 25 antibody, MGC119517 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC25A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLR
Assay Information SLC25A25 Blocking Peptide, catalog no. 33R-4541, is also available for use as a blocking control in assays to test for specificity of this SLC25A25 antibody

Images

Western Blot analysis using SLC25A25 antibody (70R-6750)

SLC25A25 antibody (70R-6750) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A25 may be involved in muscle function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A25 antibody (70R-6750) | SLC25A25 antibody (70R-6750) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors