SLC25A25 antibody (70R-6787)

Rabbit polyclonal SLC25A25 antibody

Synonyms Polyclonal SLC25A25 antibody, Anti-SLC25A25 antibody, Solute Carrier Family 25 Member 25 antibody, SLCA 25, Mitochondrial Carrier Phosphate Carrier 25 antibody, KIAA1896 antibody, MGC105138 antibody, MCSC antibody, SLCA 25 antibody, SLCA-25, SCAMC-2 antibody, SLCA-25 antibody, SLC25A25, PCSCL antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen SLC25A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV
Assay Information SLC25A25 Blocking Peptide, catalog no. 33R-1596, is also available for use as a blocking control in assays to test for specificity of this SLC25A25 antibody


Western Blot analysis using SLC25A25 antibody (70R-6787)

SLC25A25 antibody (70R-6787) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A25 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC25A25 antibody (70R-6787) | SLC25A25 antibody (70R-6787) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors