SLC25A28 antibody (70R-6471)

Rabbit polyclonal SLC25A28 antibody raised against the C terminal of SLC25A28

Synonyms Polyclonal SLC25A28 antibody, Anti-SLC25A28 antibody, NPD016 antibody, SLCA28-25 antibody, SLC25A28, Solute Carrier Family 25 Member 28 antibody, SLCA28-25, SLCA28 25, MFRN2 antibody, DKFZp547C109 antibody, MRS4L antibody, SLCA28 25 antibody, MRS3/4 antibody
Specificity SLC25A28 antibody was raised against the C terminal of SLC25A28
Cross Reactivity Human
Applications WB
Immunogen SLC25A28 antibody was raised using the C terminal of SLC25A28 corresponding to a region with amino acids NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST
Assay Information SLC25A28 Blocking Peptide, catalog no. 33R-6904, is also available for use as a blocking control in assays to test for specificity of this SLC25A28 antibody

Images

Immunohistochemical staining using SLC25A28 antibody (70R-6471)

SLC25A28 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC25A28 antibody (70R-6471) | SLC25A28 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SLC25A28 antibody (70R-6471) | SLC25A28 antibody (70R-6471) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors