SLC25A28 antibody (70R-6475)

Rabbit polyclonal SLC25A28 antibody raised against the middle region of SLC25A28

Synonyms Polyclonal SLC25A28 antibody, Anti-SLC25A28 antibody, MRS4L antibody, Solute Carrier Family 25 Member 28 antibody, DKFZp547C109 antibody, MRS3/4 antibody, SLCA28 25 antibody, NPD016 antibody, MFRN2 antibody, SLCA28-25, SLC25A28, SLCA28-25 antibody, SLCA28 25
Specificity SLC25A28 antibody was raised against the middle region of SLC25A28
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC25A28 antibody was raised using the middle region of SLC25A28 corresponding to a region with amino acids VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH
Assay Information SLC25A28 Blocking Peptide, catalog no. 33R-9911, is also available for use as a blocking control in assays to test for specificity of this SLC25A28 antibody

Images

Western Blot analysis using SLC25A28 antibody (70R-6475)

SLC25A28 antibody (70R-6475) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A28 antibody (70R-6475) | SLC25A28 antibody (70R-6475) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors