SLC25A29 antibody (70R-1740)

Rabbit polyclonal SLC25A29 antibody raised against the C terminal of SLC25A29

Synonyms Polyclonal SLC25A29 antibody, Anti-SLC25A29 antibody, FLJ38975 antibody, SLC25A29, SLCA29 25, SLCA29-25, Solute Carrier Family 25 Member 29 antibody, SLCA29-25 antibody, C14orf69 antibody, SLCA29 25 antibody
Specificity SLC25A29 antibody was raised against the C terminal of SLC25A29
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen SLC25A29 antibody was raised using the C terminal of SLC25A29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA
Assay Information SLC25A29 Blocking Peptide, catalog no. 33R-1129, is also available for use as a blocking control in assays to test for specificity of this SLC25A29 antibody

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC25A29 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A29 belongs to the mitochondrial carrier family and it may has palmitoylcarnitine transporting activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors