SLC25A31 antibody (70R-6470)

Rabbit polyclonal SLC25A31 antibody

Synonyms Polyclonal SLC25A31 antibody, Anti-SLC25A31 antibody, SLCA31-25, SFEC35kDa antibody, Mitochondrial Carrier Adenine Nucleotide Translocator 31 antibody, ANT4 antibody, AAC4 antibody, SLC25A31, Solute Carrier Family 25 Member 31 antibody, SLCA31-25 antibody, SLCA31 25 antibody, SLCA31 25, DKFZp434N1235 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC25A31 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP
Assay Information SLC25A31 Blocking Peptide, catalog no. 33R-4767, is also available for use as a blocking control in assays to test for specificity of this SLC25A31 antibody

Images

Western Blot analysis using SLC25A31 antibody (70R-6470)

SLC25A31 antibody (70R-6470) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A31 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase against ADP produced in cytosol by most energy-consuming reactions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A31 antibody (70R-6470) | SLC25A31 antibody (70R-6470) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors