SLC25A32 antibody (70R-6494)

Rabbit polyclonal SLC25A32 antibody raised against the N terminal of SLC25A32

Synonyms Polyclonal SLC25A32 antibody, Anti-SLC25A32 antibody, SLC25A32, MFTC antibody, SLCA32 25 antibody, SLCA32-25, MFT antibody, SLCA32 25, FLJ23872 antibody, Solute Carrier Family 25 Member 32 antibody, SLCA32-25 antibody
Specificity SLC25A32 antibody was raised against the N terminal of SLC25A32
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen SLC25A32 antibody was raised using the N terminal of SLC25A32 corresponding to a region with amino acids VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT
Assay Information SLC25A32 Blocking Peptide, catalog no. 33R-9795, is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Images

Western Blot analysis using SLC25A32 antibody (70R-6494)

SLC25A32 antibody (70R-6494) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A32 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A32 antibody (70R-6494) | SLC25A32 antibody (70R-6494) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors