SLC25A33 Blocking Peptide (33R-10367)

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A33 antibody, catalog no. 70R-10096

Synonyms SLC25A33 control peptide, SLC25A33 antibody Blocking Peptide, Anti-SLC25A33 Blocking Peptide, solute carrier family 25, member 33 Blocking Peptide, BMSC-MCP Blocking Peptide, MGC4399 Blocking Peptide, SLC25A33, SLCA33-25, SLCA33 25, SLCA33-25 Blocking Peptide, SLCA33 25 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYA
Molecular Weight 35 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A33 belongs to the SLC25 family of mitochondrial carrier proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors