SLC25A38 antibody (70R-6469)

Rabbit polyclonal SLC25A38 antibody raised against the middle region of SLC25A38

Synonyms Polyclonal SLC25A38 antibody, Anti-SLC25A38 antibody, SLCA38-25 antibody, FLJ20551 antibody, FLJ22703 antibody, SLCA38 25, SLCA38-25, SLCA38 25 antibody, SLC25A38, Solute Carrier Family 25 Member 38 antibody
Specificity SLC25A38 antibody was raised against the middle region of SLC25A38
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen SLC25A38 antibody was raised using the middle region of SLC25A38 corresponding to a region with amino acids VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR
Assay Information SLC25A38 Blocking Peptide, catalog no. 33R-9563, is also available for use as a blocking control in assays to test for specificity of this SLC25A38 antibody

Images

Immunohistochemical staining using SLC25A38 antibody (70R-6469)

SLC25A38 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A38 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A38 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC25A38 antibody (70R-6469) | SLC25A38 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using SLC25A38 antibody (70R-6469) | SLC25A38 antibody (70R-6469) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors