SLC25A39 antibody (70R-6509)

Rabbit polyclonal SLC25A39 antibody raised against the C terminal of SLC25A39

Synonyms Polyclonal SLC25A39 antibody, Anti-SLC25A39 antibody, Solute Carrier Family 25 Member 39 antibody, CGI69 antibody, SLCA39-25 antibody, SLC25A39, SLCA39 25 antibody, CGI-69 antibody, FLJ22407 antibody, SLCA39 25, SLCA39-25
Specificity SLC25A39 antibody was raised against the C terminal of SLC25A39
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen SLC25A39 antibody was raised using the C terminal of SLC25A39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF
Assay Information SLC25A39 Blocking Peptide, catalog no. 33R-8252, is also available for use as a blocking control in assays to test for specificity of this SLC25A39 antibody

Images

Immunohistochemical staining using SLC25A39 antibody (70R-6509)

SLC25A39 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC25A39 antibody (70R-6509) | SLC25A39 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using SLC25A39 antibody (70R-6509) | SLC25A39 antibody (70R-6509) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors