SLC25A4 antibody (70R-6504)

Rabbit polyclonal SLC25A4 antibody

Synonyms Polyclonal SLC25A4 antibody, Anti-SLC25A4 antibody, SLCA4 25, ANT1 antibody, PEO3 antibody, SLC25A4, SLCA4 25 antibody, PEO2 antibody, ANT antibody, T1 antibody, SLCA4-25 antibody, SLCA4-25, Mitochondrial Carrier Adenine Nucleotide Translocator 4 antibody, Solute Carrier Family 25 Member 4 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC25A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
Assay Information SLC25A4 Blocking Peptide, catalog no. 33R-5186, is also available for use as a blocking control in assays to test for specificity of this SLC25A4 antibody

Images

Western Blot analysis using SLC25A4 antibody (70R-6504)

SLC25A4 antibody (70R-6504) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A4 antibody (70R-6504) | SLC25A4 antibody (70R-6504) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors