SLC25A46 antibody (70R-6512)

Rabbit polyclonal SLC25A46 antibody raised against the C terminal of SLC25A46

Synonyms Polyclonal SLC25A46 antibody, Anti-SLC25A46 antibody, SLCA46-25, SLCA46 25, SLC25A46, SLCA46 25 antibody, SLCA46-25 antibody, Solute Carrier Family 25 Member 46 antibody
Specificity SLC25A46 antibody was raised against the C terminal of SLC25A46
Cross Reactivity Human,Mouse
Applications WB
Immunogen SLC25A46 antibody was raised using the C terminal of SLC25A46 corresponding to a region with amino acids LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH
Assay Information SLC25A46 Blocking Peptide, catalog no. 33R-5100, is also available for use as a blocking control in assays to test for specificity of this SLC25A46 antibody

Images

Western Blot analysis using SLC25A46 antibody (70R-6512)

SLC25A46 antibody (70R-6512) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A46 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A46 antibody (70R-6512) | SLC25A46 antibody (70R-6512) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors