SLC25A6 antibody (70R-6466)

Rabbit polyclonal SLC25A6 antibody

Synonyms Polyclonal SLC25A6 antibody, Anti-SLC25A6 antibody, SLCA6 25 antibody, SLC25A6, SLCA6-25, Mitochondrial Carrier Adenine Nucleotide Translocator 6 antibody, Solute Carrier Family 25 Member 6 antibody, ANT3 antibody, ANT3Y antibody, SLCA6-25 antibody, MGC17525 antibody, SLCA6 25
Cross Reactivity Human
Applications WB
Immunogen SLC25A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ
Assay Information SLC25A6 Blocking Peptide, catalog no. 33R-5346, is also available for use as a blocking control in assays to test for specificity of this SLC25A6 antibody

Images

Western Blot analysis using SLC25A6 antibody (70R-6466)

SLC25A6 antibody (70R-6466) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A6 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. SLC25A6 may participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC25A6 antibody (70R-6466) | SLC25A6 antibody (70R-6466) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors