SLC26A1 antibody (70R-6308)

Rabbit polyclonal SLC26A1 antibody

Synonyms Polyclonal SLC26A1 antibody, Anti-SLC26A1 antibody, SAT-1 antibody, SAT1 antibody, EDM4 antibody, SLC26A1, SLCA1 26 antibody, Sulfate Transporter 1 antibody, SLCA1-26, SLCA1 26, Solute Carrier Family 26 Member 1 antibody, SLCA1-26 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC26A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA
Assay Information SLC26A1 Blocking Peptide, catalog no. 33R-5575, is also available for use as a blocking control in assays to test for specificity of this SLC26A1 antibody

Images

Immunohistochemical staining using SLC26A1 antibody (70R-6308)

SLC26A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC26A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC26A1 antibody (70R-6308) | SLC26A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X
  • Western Blot analysis using SLC26A1 antibody (70R-6308) | SLC26A1 antibody (70R-6308) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors