SLC26A4 antibody (70R-7041)

Rabbit polyclonal SLC26A4 antibody raised against the middle region of SLC26A4

Synonyms Polyclonal SLC26A4 antibody, Anti-SLC26A4 antibody, PDS antibody, SLC26A4, DFNB4 antibody, Solute Carrier Family 26 Member 4 antibody, SLCA4 26, SLCA4-26 antibody, SLCA4-26, SLCA4 26 antibody
Specificity SLC26A4 antibody was raised against the middle region of SLC26A4
Cross Reactivity Human,Mouse
Applications WB
Immunogen SLC26A4 antibody was raised using the middle region of SLC26A4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL
Assay Information SLC26A4 Blocking Peptide, catalog no. 33R-2563, is also available for use as a blocking control in assays to test for specificity of this SLC26A4 antibody

Images

Western Blot analysis using SLC26A4 antibody (70R-7041)

SLC26A4 antibody (70R-7041) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC26A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC26A4 antibody (70R-7041) | SLC26A4 antibody (70R-7041) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors