SLC27A2 antibody (70R-7262)

Rabbit polyclonal SLC27A2 antibody

Synonyms Polyclonal SLC27A2 antibody, Anti-SLC27A2 antibody, VLACS antibody, Solute Carrier Family 27 Member 2 antibody, hFACVL1 antibody, SLCA2-27, VLCS antibody, HsT17226 antibody, SLC27A2, ACSVL1 antibody, FATP2 antibody, SLCA2 27, FACVL1 antibody, Fatty Acid Transporter 2 antibody, SLCA2-27 antibody, SLCA2 27 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC27A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Assay Information SLC27A2 Blocking Peptide, catalog no. 33R-5137, is also available for use as a blocking control in assays to test for specificity of this SLC27A2 antibody

Images

Immunohistochemical staining using SLC27A2 antibody (70R-7262)

SLC27A2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC27A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC27A2 antibody (70R-7262) | SLC27A2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SLC27A2 antibody (70R-7262) | SLC27A2 antibody (70R-7262) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors