SLC27A3 antibody (70R-6751)

Rabbit polyclonal SLC27A3 antibody

Synonyms Polyclonal SLC27A3 antibody, Anti-SLC27A3 antibody, MGC4365 antibody, SLC27A3, Solute Carrier Family 27 Member 3 antibody, SLCA3 27, Fatty Acid Transporter 3 antibody, SLCA3 27 antibody, FATP3 antibody, SLCA3-27 antibody, ACSVL3 antibody, VLCS-3 antibody, SLCA3-27
Cross Reactivity Human
Applications WB
Immunogen SLC27A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP
Assay Information SLC27A3 Blocking Peptide, catalog no. 33R-7087, is also available for use as a blocking control in assays to test for specificity of this SLC27A3 antibody

Images

Western Blot analysis using SLC27A3 antibody (70R-6751)

SLC27A3 antibody (70R-6751) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC27A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC27A3 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.SLC27A3 does not exhibit fatty acid transport activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC27A3 antibody (70R-6751) | SLC27A3 antibody (70R-6751) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors