SLC27A5 antibody (70R-7500)

Rabbit polyclonal SLC27A5 antibody

Synonyms Polyclonal SLC27A5 antibody, Anti-SLC27A5 antibody, SLCA5 27, SLCA5-27, FACVL3 antibody, SLC27A5, FATP5 antibody, Solute Carrier Family 27 Member 5 antibody, VLCSH2 antibody, Fatty Acid Transporter 5 antibody, FLJ22987 antibody, SLCA5 27 antibody, SLCA5-27 antibody, ACSB antibody, ACSVL6 antibody, VLCS-H2 antibody, VLACSR antibody
Cross Reactivity Human
Applications WB
Immunogen SLC27A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD
Assay Information SLC27A5 Blocking Peptide, catalog no. 33R-4549, is also available for use as a blocking control in assays to test for specificity of this SLC27A5 antibody

Images

Western Blot analysis using SLC27A5 antibody (70R-7500)

SLC27A5 antibody (70R-7500) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC27A5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC27A5 antibody (70R-7500) | SLC27A5 antibody (70R-7500) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors