SLC29A2 antibody (70R-7165)

Rabbit polyclonal SLC29A2 antibody

Synonyms Polyclonal SLC29A2 antibody, Anti-SLC29A2 antibody, SLCA2 29 antibody, Solute Carrier Family 29 Member 2 antibody, SLCA2-29 antibody, SLCA2-29, Nucleoside Transporters 2 antibody, HNP36 antibody, SLC29A2, SLCA2 29, ENT2 antibody, DER12 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC29A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV
Assay Information SLC29A2 Blocking Peptide, catalog no. 33R-7199, is also available for use as a blocking control in assays to test for specificity of this SLC29A2 antibody

Images

Western Blot analysis using SLC29A2 antibody (70R-7165)

SLC29A2 antibody (70R-7165) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC29A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC29A2 antibody (70R-7165) | SLC29A2 antibody (70R-7165) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors