SLC30A3 antibody (70R-6762)

Rabbit polyclonal SLC30A3 antibody

Synonyms Polyclonal SLC30A3 antibody, Anti-SLC30A3 antibody, SLCA3-30 antibody, Solute Carrier Family 30 Member 3 antibody, SLCA3 30 antibody, SLCA3-30, ZNT3 antibody, SLCA3 30, SLC30A3
Cross Reactivity Human
Applications WB
Immunogen SLC30A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLG
Assay Information SLC30A3 Blocking Peptide, catalog no. 33R-1388, is also available for use as a blocking control in assays to test for specificity of this SLC30A3 antibody


Western Blot analysis using SLC30A3 antibody (70R-6762)

SLC30A3 antibody (70R-6762) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC30A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC30A3 is involved in accumulation of zinc in synaptic vesicles.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC30A3 antibody (70R-6762) | SLC30A3 antibody (70R-6762) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors