SLC30A8 antibody (70R-6325)

Rabbit polyclonal SLC30A8 antibody

Synonyms Polyclonal SLC30A8 antibody, Anti-SLC30A8 antibody, SLCA8 30 antibody, Solute Carrier Family 30 Member 8 antibody, SLCA8-30 antibody, SLC30A8, SLCA8 30, ZnT-8 antibody, SLCA8-30
Cross Reactivity Human
Applications WB
Immunogen SLC30A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG
Assay Information SLC30A8 Blocking Peptide, catalog no. 33R-5148, is also available for use as a blocking control in assays to test for specificity of this SLC30A8 antibody

Images

Western Blot analysis using SLC30A8 antibody (70R-6325)

SLC30A8 antibody (70R-6325) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC30A8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC30A8 antibody (70R-6325) | SLC30A8 antibody (70R-6325) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors