SLC33A1 antibody (70R-6798)

Rabbit polyclonal SLC33A1 antibody

Synonyms Polyclonal SLC33A1 antibody, Anti-SLC33A1 antibody, Solute Carrier Family 33 Member 1 antibody, SLCA1 33 antibody, SLCA1-33, SLC33A1, SLCA1 33, ACATN antibody, SLCA1-33 antibody, AT-1 antibody, AT1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC33A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG
Assay Information SLC33A1 Blocking Peptide, catalog no. 33R-1757, is also available for use as a blocking control in assays to test for specificity of this SLC33A1 antibody

Images

Western Blot analysis using SLC33A1 antibody (70R-6798)

SLC33A1 antibody (70R-6798) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC33A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC33A1 antibody (70R-6798) | SLC33A1 antibody (70R-6798) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors