SLC35A3 antibody (70R-7368)

Rabbit polyclonal SLC35A3 antibody

Synonyms Polyclonal SLC35A3 antibody, Anti-SLC35A3 antibody, SLC35A3, Solute Carrier Family 35 Member A3 antibody, SLCA3-35 antibody, SLCA3 35 antibody, Udp-N-Acetylglucosamine Transporter A3 antibody, SLCA3 35, SLCA3-35, DKFZp781P1297 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC35A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKET
Assay Information SLC35A3 Blocking Peptide, catalog no. 33R-9415, is also available for use as a blocking control in assays to test for specificity of this SLC35A3 antibody

Images

Western Blot analysis using SLC35A3 antibody (70R-7368)

SLC35A3 antibody (70R-7368) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC35A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC35A3 is a uridine diphosphate-N-acetylglucosamine transporter in the Golgi apparatus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC35A3 antibody (70R-7368) | SLC35A3 antibody (70R-7368) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors