SLC35D3 antibody (70R-6652)

Rabbit polyclonal SLC35D3 antibody raised against the N terminal of SLC35D3

Synonyms Polyclonal SLC35D3 antibody, Anti-SLC35D3 antibody, SLCD3 35 antibody, bA55K22.3 antibody, SLCD3-35 antibody, MGC102873 antibody, SLCD3 35, SLC35D3, SLCD3-35, FRCL1 antibody, Solute Carrier Family 35 Member D3 antibody
Specificity SLC35D3 antibody was raised against the N terminal of SLC35D3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC35D3 antibody was raised using the N terminal of SLC35D3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVL
Assay Information SLC35D3 Blocking Peptide, catalog no. 33R-8281, is also available for use as a blocking control in assays to test for specificity of this SLC35D3 antibody

Images

Western Blot analysis using SLC35D3 antibody (70R-6652)

SLC35D3 antibody (70R-6652) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC35D3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC35D3 may play a role in hemostasis as a regulator of the biosynthesis of platelet-dense granules.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC35D3 antibody (70R-6652) | SLC35D3 antibody (70R-6652) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors